PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_2299g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SRS
Protein Properties Length: 365aa    MW: 38827.6 Da    PI: 7.7376
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_2299g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7021976e-611743136154
        DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                    +CqdCGnqakkdC h+RCRtCCksrgfdC thvkstWvpaa+rrerqq+++  ++++        +kr+r   +   +a    +++   ++  + +
  MA_2299g0010 174 NTCQDCGNQAKKDCFHMRCRTCCKSRGFDCPTHVKSTWVPAARRRERQQHQEEGTRRN------VPTKRQRPAGIIPDAAPPPHSVA---AQVLTVK 261
                   68*********************************************99988875544......45666666655555555555543...3456778 PP

        DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                   +slP+ev+ +avf+cv+v++++dge+e+aYq++v+igGh+fkG+L+dqGl++
  MA_2299g0010 262 ESLPAEVRGQAVFKCVKVTAMEDGEDEYAYQATVKIGGHIFKGVLHDQGLDT 313
                   89***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.4E-59174312IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.7E-28175217IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.7E-28264311IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDMVKDVISG GGGGASGSRR TSATGGEDQE IQREYICSTS SSSIAARKSR NLNLVPFQGF  60
DGGSYGYPSH GIVSTSDVGM AMGGMVGLGV VGGGLGIGVG AGGNVSIDLA NIYSQRGGVS  120
SLLSAPQATS EEQWKQQQQM LFEDKVMIME KSSENKEDQD DKKKGNLVLG LPSNTCQDCG  180
NQAKKDCFHM RCRTCCKSRG FDCPTHVKST WVPAARRRER QQHQEEGTRR NVPTKRQRPA  240
GIIPDAAPPP HSVAAQVLTV KESLPAEVRG QAVFKCVKVT AMEDGEDEYA YQATVKIGGH  300
IFKGVLHDQG LDTSIGPSSF ADHQLGGRSM ASTSAMVDPA QMYGASSSAF LGEVYLKLMG  360
QNLSH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0L9VII21e-53A0A0L9VII2_PHAAN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.28e-43Lateral root primordium (LRP) protein-related